PDB entry 6cg9

View 6cg9 on RCSB PDB site
Description: Crystal structure of Triosephosphate Isomerase from Zea mays (mexican corn)
Class: isomerase
Keywords: Isomerase, Glycolysis, TIM-barrel
Deposited on 2018-02-19, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, cytosolic
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cg9a_
  • Chain 'B':
    Compound: Triosephosphate isomerase, cytosolic
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12863 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6cg9b1, d6cg9b2
  • Heterogens: GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cg9A (A:)
    gshmgrkffvggnwkcngttdqvekivktlnegqvppsdvvevvvsppyvflpvvksqlr
    qefhvaaqncwvkkggaftgevsaemlvnlgvpwvilghserrallgesnefvgdkvaya
    lsqglkviacvgetleqreagstmdvvaaqtkaiaekikdwsnvvvayepvwaigtgkva
    tpaqaqevhaslrdwlktnaspevaestriiyggsvtaanckelaaqpdvdgflvggasl
    kpefidiinaatvksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cg9A (A:)
    grkffvggnwkcngttdqvekivktlnegqvppsdvvevvvsppyvflpvvksqlrqefh
    vaaqncwvkkggaftgevsaemlvnlgvpwvilghserrallgesnefvgdkvayalsqg
    lkviacvgetleqreagstmdvvaaqtkaiaekikdwsnvvvayepvwaigtgkvatpaq
    aqevhaslrdwlktnaspevaestriiyggsvtaanckelaaqpdvdgflvggaslkpef
    idiinaatv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cg9B (B:)
    gshmgrkffvggnwkcngttdqvekivktlnegqvppsdvvevvvsppyvflpvvksqlr
    qefhvaaqncwvkkggaftgevsaemlvnlgvpwvilghserrallgesnefvgdkvaya
    lsqglkviacvgetleqreagstmdvvaaqtkaiaekikdwsnvvvayepvwaigtgkva
    tpaqaqevhaslrdwlktnaspevaestriiyggsvtaanckelaaqpdvdgflvggasl
    kpefidiinaatvksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cg9B (B:)
    gshmgrkffvggnwkcngttdqvekivktlnegqvppsdvvevvvsppyvflpvvksqlr
    qefhvaaqncwvkkggaftgevsaemlvnlgvpwvilghserrallgesnefvgdkvaya
    lsqglkviacvgetleqreagstmdvvaaqtkaiaekikdwsnvvvayepvwaigtgkva
    tpaqaqevhaslrdwlktnaspevaestriiyggsvtaanckelaaqpdvdgflvggasl
    kpefidiinaatvk