PDB entry 6cg6

View 6cg6 on RCSB PDB site
Description: mouse cadherin-10 EC1-2 adhesive fragment
Class: cell adhesion
Keywords: Cadherin EC domain Dimer Extracellular, CELL ADHESION
Deposited on 2018-02-19, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-10
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cg6a1, d6cg6a2
  • Heterogens: CA, EDO, TAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cg6A (A:)
    gwmwnqfflleeytgsdyqyvgklhsdqdkgdgslkyilsgdgagtlfiidektgdihat
    rridreekafytlraqainrrtlrpvepesefvikihdindneptfpeeiytasvpemsv
    vgtsvvqvtatdaddpsygnsarviysilqgqpyfsvepetgiirtalpnmnrenkeqyq
    vviqakdmggqmgglsgtttvnitltd