PDB entry 6cg2

View 6cg2 on RCSB PDB site
Description: Crystal Structure of KDM4A with Compound 8
Class: oxidoreductase/inhibitor
Keywords: KDM4A, Small Molecule Inhibitor, Demethylase, OXIDOREDUCTASE, OXIDOREDUCTASE-INHIBITOR complex
Deposited on 2018-02-19, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cg2a_
  • Chain 'B':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cg2b_
  • Chain 'C':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cg2c_
  • Chain 'D':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cg2d_
  • Heterogens: NI, ZN, QC2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cg2A (A:)
    setlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddidd
    lvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywkn
    ltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwkts
    fawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtl
    isplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqav
    lcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cg2A (A:)
    tlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlv
    ipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknlt
    fnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfa
    whtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlis
    plmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlc
    scrvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cg2B (B:)
    setlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddidd
    lvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywkn
    ltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwkts
    fawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtl
    isplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqav
    lcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cg2B (B:)
    setlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddidd
    lvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywkn
    ltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwkts
    fawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtl
    isplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqav
    lcscrvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cg2C (C:)
    setlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddidd
    lvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywkn
    ltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwkts
    fawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtl
    isplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqav
    lcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cg2C (C:)
    arimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvipapi
    qqlvtgqsglftqyniqkkamtvrefrkiansdkyctpryfeelerkywknltfnppiyg
    advngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfawhtedmd
    lysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplmlkky
    gipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscrkism
    dvfvrkfqperyklwkagktvidhtlptpeaaefl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cg2D (D:)
    setlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddidd
    lvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywkn
    ltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwkts
    fawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtl
    isplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqav
    lcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cg2D (D:)
    setlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddidd
    lvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywkn
    ltfnppiygadvngtlyekhvdewnigrlrtildlvekesgvntpylyfgmwktsfawht
    edmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplm
    lkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscr
    vkismdvfvrkfqperyklwkagkdntvidhtlptpeaaef