PDB entry 6cfs

View 6cfs on RCSB PDB site
Description: Structure of Human alpha-Phosphomannomutase 1 containing mutation M186Q
Class: isomerase
Keywords: phosphatase, haloalkanoate dehalogenase superfamily, mutase, ISOMERASE
Deposited on 2018-02-17, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphomannomutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PMM1, PMMH22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92871
      • engineered mutation (185)
    Domains in SCOPe 2.07: d6cfsa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cfsA (A:)
    mavtaqaarrkervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckia
    eqlgdgdeviekfdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallr
    lpkkrgtfiefrngmlnispigrsctleeriefseldkkekirekfvealktefagkglr
    fsrggqisfdvfpegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsv
    vspqdtvqrcreiffpetahea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfsA (A:)
    ervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckiaeqlgdgdevie
    kfdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallrlpkkrgtfief
    rngmlnispigrsctleeriefseldkkekirekfvealktefagkglrfsrggqisfdv
    fpegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsvvspqdtvqrcr
    eiffp