PDB entry 6cfp

View 6cfp on RCSB PDB site
Description: crystal structure of polymerase acid protein (pa) from influenza a virus, wilson-smith/1933 (h1n1) bound to fragment hit bsi-70565 1-{1-[4-fluorophenyl)methyl]-2-methyl-1h-imidazol-4-yl}ethan-1-one
Class: viral protein
Keywords: INFLUENZA, H1N1, FRAGMENT-BASED DRUG DISCOVERY, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, VIRAL PROTEIN
Deposited on 2018-02-15, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein SMT3,Polymerase acidic protein
    Species: Influenza A virus [TaxId:381518]
    Gene: PA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfpa_
  • Heterogens: EZS, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cfpA (A:)
    mghhhhhhsgevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemds
    lrflydgiriqadqtpedldmedndiieahreqiggnariepflkstprplrlpdgppcs
    qrskfllmdalklsiedpshegegiplydaikcmrtffgwkepnvvkphekginpnylls
    wkqvlaelqdieneekiprtknmkktsqlkwalgenmapekvdfddckdvgdlkqydsde
    pelrslaswiqnefnkaceltdsswieldeigedaapiehiasmrrnyftaevshcrate
    yimkgvyintallnascaamddfqlipmiskcrtkegrrktnlygfiikgrshlrndtdv
    vnfvsmefsltdprlephkwekycvlevgdmllrsaighvsrpmflyvrtngtskikmkw
    gmemrrcllqslqqiesmieaessvkekdmtkeffenksetwpvgespkgveegsigkvc
    rtllaksvfnslyaspqlegfsaesrklllivqalrdnlepgtfdlgglyeaieeclind
    pwvllnaswfnsflthalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfpA (A:)
    rplrlpdgppcsqrskfllmdalklsiedpgiplydaikcmrtffgwkepnvvkphekgi
    npnyllswkqvlaelqdieneekiprtknmkktsqlkwalgeelrslaswiqnefnkace
    ltdsswieldeigedaapiehiasmrrnyftaevshcrateyimkgvyintallnascaa
    mddfqlipmiskcrtkegrrktnlygfiikgrshlrndtdvvnfvsmefsltdprlephk
    wekycvlevgdmllrsaighvsrpmflyvrtngtskikmkwgmemrrcllqslqqiesmi
    eaessvkekdmtkeffenkspkgveegsigkvcrtllaksvfnslyaspqlegfsaesrk
    lllivqalrdnlgglyeaieeclindpwvllnaswfnsflth