PDB entry 6cfg

View 6cfg on RCSB PDB site
Description: Crystal structure of the A/Vietnam/1203/2004 (H5N1) influenza virus hemagglutinin in complex with small molecule JNJ4796
Class: viral protein
Keywords: Glycoprotein, Ectodomain, N-glycosylation, VIRAL PROTEIN
Deposited on 2018-02-14, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP31 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d6cfga1, d6cfga2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ18 (0-173)
      • expression tag (174-175)
    Domains in SCOPe 2.07: d6cfgb1, d6cfgb2
  • Heterogens: NAG, EZ7, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cfgA (A:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfgA (A:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cfgB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfgB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissg