PDB entry 6cff

View 6cff on RCSB PDB site
Description: Stimulator of Interferon Genes Human
Class: immune system
Keywords: human STING, complex, cyclic-di-AMP, TMEM173, wild type, 230G/232R, IMMUNE SYSTEM
Deposited on 2018-02-14, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stimulator of interferon genes protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TMEM173, ERIS, MITA, STING
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cffa_
  • Heterogens: 2BA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cffA (A:)
    lapaeisavcekgnfnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrl
    yillpldcgvpdnlsmadpnirfldklpqqtgdragikdrvysnsiyellengqragtcv
    leyatplqtlfamsqysqagfsredrleqaklfcrtlediladapesqnncrliayqepa
    ddssfslsqevlrhlrqeekeevtvgslktsavpststmsqepellisgmekplplrtdf
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cffA (A:)
    nvahglawsyyigylrlilpelqarirtynqavsqrlyillpldcgvpdnlsmadpnirf
    ldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfamsqysqagfsr
    edrleqaklfcrtlediladapesqnncrliayqepslsqevlrhlrq