PDB entry 6cf5

View 6cf5 on RCSB PDB site
Description: Crystal structure of the A/Viet Nam/1203/2004(H5N1) influenza virus hemagglutinin in complex with small molecule N-Cyclohexyltaurine
Class: viral protein
Keywords: Glycoprotein, Ectodomain, N-glycosylation, VIRAL PROTEIN
Deposited on 2018-02-13, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP31 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d6cf5a1, d6cf5a2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ18 (0-173)
      • expression tag (174-175)
    Domains in SCOPe 2.07: d6cf5b1, d6cf5b2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP31 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6cf5c1, d6cf5c2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ18 (0-173)
      • expression tag (174-175)
    Domains in SCOPe 2.07: d6cf5d1, d6cf5d2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP31 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6cf5e1, d6cf5e2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ18 (0-173)
      • expression tag (174)
    Domains in SCOPe 2.07: d6cf5f1, d6cf5f2
  • Heterogens: NHE, NAG, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cf5A (A:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf5A (A:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cf5B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf5B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cf5C (C:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf5C (C:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsva
    gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
    ksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrnsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cf5D (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf5D (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6cf5E (E:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf5E (E:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsva
    gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
    ksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrnsp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6cf5F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf5F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss