PDB entry 6cf1

View 6cf1 on RCSB PDB site
Description: Proteus vulgaris HigA antitoxin structure
Class: antitoxin
Keywords: Helix-turn-helix motif, transcriptional regulator, toxin-antitoxin, ANTITOXIN
Deposited on 2018-02-13, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antitoxin higa
    Species: Proteus vulgaris [TaxId:585]
    Gene: higa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cf1a_
  • Chain 'B':
    Compound: antitoxin higa
    Species: Proteus vulgaris [TaxId:585]
    Gene: higa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cf1b_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cf1A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmrqfkvshpgemiardledmgvsgrr
    fahnigvtpatvsrllagktaltpslsiriaaalgstpefwlrlqsnydlrqlenqidts
    givlygesneqqqnaqeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf1A (A:)
    qfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaalgs
    tpefwlrlqsnydlrqlenqidtsgivlyges
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cf1B (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmrqfkvshpgemiardledmgvsgrr
    fahnigvtpatvsrllagktaltpslsiriaaalgstpefwlrlqsnydlrqlenqidts
    givlygesneqqqnaqeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf1B (B:)
    vshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaalgstpe
    fwlrlqsnydlrqlenqidtsgivlygesneqqq