PDB entry 6ce2

View 6ce2 on RCSB PDB site
Description: Crystal structure of Myotoxin I (MjTX-I) from Bothrops moojeni complexed to inhibitor suramin
Class: toxin
Keywords: Myotoxin I, MjTX-I, PLA2-like, Suramin, TOXIN
Deposited on 2018-02-10, released 2018-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic phospholipase A2 homolog 1
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82114 (0-120)
      • conflict (17)
      • conflict (57)
    Domains in SCOPe 2.08: d6ce2a_
  • Chain 'B':
    Compound: Basic phospholipase A2 homolog 1
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82114 (0-120)
      • conflict (17)
      • conflict (57)
    Domains in SCOPe 2.08: d6ce2b_
  • Heterogens: SVR, PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ce2A (A:)
    slvelgkmilqetgknpvksygaygcncgvlgrgkpkdatdrccyvhkccykkltncnpk
    kdrysydwknktivcgeenpclkqlcecdkavaiclrenkgtynkkrdvylkpfcdkgrd
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ce2B (B:)
    slvelgkmilqetgknpvksygaygcncgvlgrgkpkdatdrccyvhkccykkltncnpk
    kdrysydwknktivcgeenpclkqlcecdkavaiclrenkgtynkkrdvylkpfcdkgrd
    c