PDB entry 6ce1

View 6ce1 on RCSB PDB site
Description: Crystal structure of Peptidyl Arginine Deiminase Type III (PADI3)
Class: hydrolase
Keywords: Citrullination Calcium Follicle Hair Skin, HYDROLASE
Deposited on 2018-02-10, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-arginine deiminase type-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PADI3, PAD3, PDI3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ce1a1, d6ce1a2, d6ce1a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ce1A (A:)
    msyyhhhhhhlestslykkagfmslqrivrvslehptsavcvagvetlvdiygsvpegte
    mfevygtpgvdiyispnmergreradtrrwrfdatleiivvmnspsndlndshvqisyhs
    sheplplayavlyltcvdisldcdlncegrqdrnfvdkrqwvwgpsgyggillvncdrdd
    pscdvqdncdqhvhclqdledmsvmvlrtqgpaalfddhklvlhtssydakraqvfhicg
    pedvceayrhvlgqdkvsyevprlhgdeerffveglsfpdagftglisfhvtllddsned
    fsaspiftdtvvfrvapwimtpstlpplevyvcrvrnntcfvdavaelarkagcklticp
    qaenrndrwiqdemelgyvqaphktlpvvfdsprngelqdfpykrilgpdfgyvtreprd
    rsvsgldsfgnlevsppvvangkeyplgriliggnlpgssgrrvtqvvrdflhaqkvqpp
    velfvdwlavghvdeflsfvpapdgkgfrmllaspgacfklfqekqkcghgrallfqgvv
    ddeqvktisinqvlsnkdlinynkfvqscidwnrevlkrelglaecdiidipqlfkterk
    kataffpdlvnmlvlgkhlgipkpfgpiingcccleekvrslleplglhctfiddftpyh
    mlhgevhcgtnvcrkpfsfkwwnmvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ce1A (A:)
    slqrivrvslehptsavcvagvetlvdiygsvpegtemfevygtpgvdiyispnmergre
    radtrrwrfdatleiivvmnspsndlndshvqisyhssheplplayavlyltcvdisldc
    dlncegrqdkrqwvwgpsgyggillvncdqdledmsvmvlrtqgpaalfddhklvlhtss
    ydakraqvfhiceayrhvlgqdkvsyevprlhgdeerffveglsfpdagftglisfhvtl
    lddsnedfsaspiftdtvvfrvapwimtpstlpplevyvcrvrnntcfvdavaelarkag
    cklticiqdemelgyvqaphktlpvvfdsrilgpdfgyvtrepsfgnlevsppvvangke
    yplgriliggnlpgssgrrvtqvvrdflhaqkvqppvelfvdwlavghvdeflsfvpapd
    gkgfrmllaspgacfklfqekqkcghgrallfqgvvddeqvktisinqvlsnkdlinynk
    fvqscidwnrevlkrelglaecdiidipqlfkterkkataffpdlvnmlvlgkhlgipkp
    fgpiingcccleekvrslleplglhctfiddftpycgtnvcrkpfsfkwwnmvp