PDB entry 6cdz

View 6cdz on RCSB PDB site
Description: E. coli thymidylate synthase mutant I264Am
Class: transferase
Keywords: transferase
Deposited on 2018-02-09, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: thyA, b2827, JW2795
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cdza_
  • Chain 'B':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: thyA, b2827, JW2795
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cdzb_
  • Heterogens: CB3, UMP, UMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cdzA (A:)
    mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
    wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
    ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
    yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
    dyrfedfeiegydphpgikapva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cdzB (B:)
    mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
    wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
    ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
    yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
    dyrfedfeiegydphpgikapva