PDB entry 6cdk

View 6cdk on RCSB PDB site
Description: characterization of the p1+ intermediate state of nitrogenase p- cluster
Deposited on 2018-02-08, released 2018-05-09
The last revision was dated 2018-07-04, with a file datestamp of 2018-06-29.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HCA, ICS, CLF, FE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6cdkA (A:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    asegaekvaasa
    

    Sequence, based on observed residues (ATOM records):
    >6cdkA (A:)
    msreevesliqevlevypekarkdrnkhlavndpsnkksqpglmtirgcayagskgvvwg
    pikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdivfggdkklak
    lidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrcegfrgvsqsl
    ghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrilleemglrcvaqw
    sgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptktieslraia
    akfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvigayedlgme
    vvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsgikekfifqk
    mgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6cdkB (B:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records):
    >6cdkB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6cdkC (C:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    asegaekvaasa
    

    Sequence, based on observed residues (ATOM records):
    >6cdkC (C:)
    msreevesliqevlevypekarkdrnkhlnciisnkksqpglmtirgcayagskgvvwgp
    ikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdivfggdkklakl
    idevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrcegfrgvsqslg
    hhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrilleemglrcvaqws
    gdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptktieslraiaa
    kfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvigayedlgmev
    vgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsgikekfifqkm
    gipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6cdkD (D:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records):
    >6cdkD (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr