PDB entry 6cd6

View 6cd6 on RCSB PDB site
Description: Crystal Structure of the Human CAMKK1A in complex with GSK650394
Class: transferase/transferase inhibitor
Keywords: protein kinase domain, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-02-08, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK1, CAMKKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd6a_
  • Chain 'B':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK1, CAMKKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N5S9 (2-289)
      • expression tag (1)
    Domains in SCOPe 2.07: d6cd6b1, d6cd6b2
  • Chain 'C':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK1, CAMKKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd6c_
  • Chain 'D':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK1, CAMKKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N5S9 (2-289)
      • expression tag (1)
    Domains in SCOPe 2.07: d6cd6d1, d6cd6d2
  • Heterogens: DXV, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cd6A (A:)
    smqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqygfprrppprgsqa
    aqggpakqllplervyqeiailkkldhvnvvklievlddpaednlylvfdllrkgpvmev
    pcdkpfseeqarlylrdvilgleylhcqkivhrdikpsnlllgddghvkiadfgvsnqfe
    gndaqlsstagtpafmapeaisdsgqsfsgkaldvwatgvtlycfvygkcpfiddfilal
    hrkiknepvvfpeepeiseelkdlilkmldknpetrigvpdiklhpwvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd6A (A:)
    lnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqqllplervyqeiailkk
    ldhvnvvklievlddpaednlylvfdllrkgpvmevpcdkpfseeqarlylrdvilgley
    lhcqkivhrdikpsnlllgddghvkiadfgvsnqfegndaqlsstagtpafmapeaisgq
    sfsgkaldvwatgvtlycfvygkcpfiddfilalhrkiknepvvfpeepeiseelkdlil
    kmldknpetrigvpdiklhpwvtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cd6B (B:)
    smqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqygfprrppprgsqa
    aqggpakqllplervyqeiailkkldhvnvvklievlddpaednlylvfdllrkgpvmev
    pcdkpfseeqarlylrdvilgleylhcqkivhrdikpsnlllgddghvkiadfgvsnqfe
    gndaqlsstagtpafmapeaisdsgqsfsgkaldvwatgvtlycfvygkcpfiddfilal
    hrkiknepvvfpeepeiseelkdlilkmldknpetrigvpdiklhpwvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd6B (B:)
    mqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqllplervyqeiailk
    kldhvnvvklievlddpaednlylvfdllrkgpvmevpcdkpfseeqarlylrdvilgle
    ylhcqkivhrdikpsnlllgddghvkiadfgvsnqfegndaqlsstagtpafmapeaiss
    gqsfsgkaldvwatgvtlycfvygkcpfiddfilalhrkiknepvvfpeepeiseelkdl
    ilkmldknpetrigvpdiklhpwvtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cd6C (C:)
    smqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqygfprrppprgsqa
    aqggpakqllplervyqeiailkkldhvnvvklievlddpaednlylvfdllrkgpvmev
    pcdkpfseeqarlylrdvilgleylhcqkivhrdikpsnlllgddghvkiadfgvsnqfe
    gndaqlsstagtpafmapeaisdsgqsfsgkaldvwatgvtlycfvygkcpfiddfilal
    hrkiknepvvfpeepeiseelkdlilkmldknpetrigvpdiklhpwvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd6C (C:)
    qlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqllplervyqeiailkk
    ldhvnvvklievlddpaednlylvfdllrkgpvmevpcdkpfseeqarlylrdvilgley
    lhcqkivhrdikpsnlllgddghvkiadfgvsnqfegndaqlsstagtpafmapeaissg
    qsfsgkaldvwatgvtlycfvygkcpfiddfilalhrkiknepvvfpeepeiseelkdli
    lkmldknpetrigvpdiklhpwvtk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cd6D (D:)
    smqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqygfprrppprgsqa
    aqggpakqllplervyqeiailkkldhvnvvklievlddpaednlylvfdllrkgpvmev
    pcdkpfseeqarlylrdvilgleylhcqkivhrdikpsnlllgddghvkiadfgvsnqfe
    gndaqlsstagtpafmapeaisdsgqsfsgkaldvwatgvtlycfvygkcpfiddfilal
    hrkiknepvvfpeepeiseelkdlilkmldknpetrigvpdiklhpwvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd6D (D:)
    mqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqllplervyqeiailk
    kldhvnvvklievlddpaednlylvfdllrkgpvmevpcdkpfseeqarlylrdvilgle
    ylhcqkivhrdikpsnlllgddghvkiadfgvsnqfegndaqlsstagtpafmapeaisd
    sgqsfsgkaldvwatgvtlycfvygkcpfiddfilalhrkiknepvvfpeepeiseelkd
    lilkmldknpetrigvpdiklhpwvtk