PDB entry 6cd1

View 6cd1 on RCSB PDB site
Description: Crystal structure of Medicago truncatula serine hydroxymethyltransferase 3 (MtSHMT3), complexes with reaction intermediates
Class: transferase
Keywords: PLP, one-carbon cycle, tetrahydrofolate, chloroplast, tetramer, PLP-Serine, PLP-Glycine, TRANSFERASE
Deposited on 2018-02-07, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd1a_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd1b_
  • Chain 'C':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd1c_
  • Chain 'D':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd1d_
  • Chain 'E':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd1e_
  • Chain 'F':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd1f_
  • Chain 'G':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd1g_
  • Chain 'H':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cd1h_
  • Heterogens: PLS, PLG, EDO, ACT, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cd1A (A:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd1A (A:)
    fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
    ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
    ldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliia
    gasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslr
    gprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqn
    qvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsv
    pgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdfln
    fvlapefplgdkvsnlrrkvealatqypipgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cd1B (B:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd1B (B:)
    ldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgkr
    yyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimgl
    dlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliiag
    asayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslrg
    prggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqnq
    vvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsvp
    gdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdflnf
    vlapefplgdkvsnlrrkvealatqypipgv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cd1C (C:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd1C (C:)
    fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
    ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
    ldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliia
    gasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslr
    gprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqn
    qvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsv
    pgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdfln
    fvlapefplgdkvsnlrrkvealatqypipgv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cd1D (D:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd1D (D:)
    ldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgkr
    yyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimgl
    dlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliiag
    asayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslrg
    prggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqnq
    vvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsvp
    gdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsvqdflnfvlf
    plgdkvsnlrrkvealatqypipgv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6cd1E (E:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd1E (E:)
    ldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgkr
    yyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimgl
    dlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliiag
    asayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslrg
    prggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqnq
    vvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsvp
    gdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdflnf
    vlapefplgdkvsnlrrkvealatqypipgv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6cd1F (F:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd1F (F:)
    ldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgkr
    yyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimgl
    dlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliiag
    asayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslrg
    prggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqnq
    vvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsvp
    gdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdflnf
    vlapefplgdkvsnlrrkvealatqypipgv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6cd1G (G:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd1G (G:)
    ldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgkr
    yyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimgl
    dlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliiag
    asayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslrg
    prggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqnq
    vvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsvp
    gdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdflnf
    vlapefplgdkvsnlrrkvealatqypipgv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6cd1H (H:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd1H (H:)
    fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
    ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
    ldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliia
    gasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslr
    gprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqn
    qvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsv
    pgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdfln
    fvlapefplgdkvsnlrrkvealatqypipgv