PDB entry 6cd0

View 6cd0 on RCSB PDB site
Description: Crystal structure of Medicago truncatula serine hydroxymethyltransferase 3 (MtSHMT3), PLP-internal aldimine and apo form
Class: transferase
Keywords: PLP, one-carbon cycle, tetrahydrofolate, chloroplast, tetramer, TRANSFERASE
Deposited on 2018-02-07, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.7400000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cd0a_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cd0b_
  • Chain 'C':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cd0c_
  • Chain 'D':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cd0d_
  • Heterogens: ACT, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cd0A (A:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd0A (A:)
    fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
    ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
    ldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliia
    gasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslr
    gprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqn
    qvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsv
    pgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdfln
    fvlapefplgdkvsnlrrkvealatqypipgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cd0B (B:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd0B (B:)
    fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
    ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
    ldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliia
    gasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslr
    gprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqn
    qvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsv
    pgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdfln
    fvlapefplgdkvsnlrrkvealatqypipgv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cd0C (C:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd0C (C:)
    fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
    ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
    ldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliia
    gasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslr
    gprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqn
    qvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsv
    pgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdfln
    fvlapefplgdkvsnlrrkvealatqypipgv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cd0D (D:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cd0D (D:)
    fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
    ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
    ldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliia
    gasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslr
    gprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqn
    qvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsv
    pgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdfln
    fvlapefplgdkvsnlrrkvealatqypipgv