PDB entry 6ccz

View 6ccz on RCSB PDB site
Description: Crystal structure of Medicago truncatula serine hydroxymethyltransferase 3 (MtSHMT3) soaked with selenourea
Class: transferase
Keywords: PLP, one-carbon cycle, tetrahydrofolate, chloroplast, tetramer, SAD phasing, TRANSFERASE
Deposited on 2018-02-07, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ccza_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Medicago truncatula [TaxId:3880]
    Gene: 11445860, MTR_2g018290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cczb_
  • Heterogens: SEY, ACT, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cczA (A:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cczA (A:)
    fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
    ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
    ldlphgghlshgfrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliiagasay
    prdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslrgprgg
    miffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqnqvvan
    cralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsvpgdvp
    ggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdflnfvlapefpl
    gdkvsnlrrkvealatqypipgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cczB (B:)
    snafldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkysegl
    pgkryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdr
    imgldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkl
    iiagasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthk
    slrgprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfkn
    yqnqvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnk
    nsvpgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqd
    flnfvlapefplgdkvsnlrrkvealatqypipgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cczB (B:)
    fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
    ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
    ldlphgghlshgfrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliiagasay
    prdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslrgprgg
    miffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqnqvvan
    cralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsvpgvpg
    girigspamttrglgekefeliadlihegvrisleakslvsgtkvqdflnfvlapefplg
    dkvsnlrrkvealatqypipgv