PDB entry 6ccy

View 6ccy on RCSB PDB site
Description: Crystal structure of Akt1 in complex with a selective inhibitor
Class: transferase/inhibitor
Keywords: kinase inhibitor, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2018-02-07, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAC-alpha serine/threonine-protein kinase,PIFtide
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT1, PKB, RAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31749 (3-End)
      • expression tag (0-2)
      • engineered mutation (58)
      • engineered mutation (255-256)
      • engineered mutation (292)
    • Uniprot Q16513 (Start-340)
      • expression tag (341-342)
    Domains in SCOPe 2.07: d6ccya1, d6ccya2, d6ccya3
  • Heterogens: EX4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ccyA (A:)
    gslrvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltesr
    vlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsa
    ldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapev
    ledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksll
    sgllkkdpkqrlgggpsdakeimqhrffagivwqhvyekklsppfkpqvtsevdtryfde
    eftaqmititppdqddsmecvdserreeqemfrdfdyiadweg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ccyA (A:)
    gslrvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltesr
    vlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsa
    ldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapev
    ledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksll
    sgllkkdpkqrlgggpsdakeimqhrffagivwqhvyekklsppfkpqvtsevdtryfde
    eftaqmititeqemfrdfdyiadweg