PDB entry 6ccj

View 6ccj on RCSB PDB site
Description: NMR structure of the Rous sarcoma virus matrix protein (M domain)
Class: viral protein
Keywords: RSV, ASV, matrix, Gag, helix, VIRAL PROTEIN
Deposited on 2018-02-07, released 2018-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virus Matrix Protein
    Species: Rous sarcoma virus (strain Prague C) [TaxId:11888]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (1-86)
      • expression tag (0)
    Domains in SCOPe 2.08: d6ccja1, d6ccja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ccjA (A:)
    seavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq
    ramilgksgelktwglvlgalkaaree