PDB entry 6ccf

View 6ccf on RCSB PDB site
Description: Crystal Structure of the Human CAMKK1A in complex with Hesperadin
Class: transferase/transferase inhibitor
Keywords: protein kinase domain, Structural Genomics, Structural Genomics Consortium, SGC, PSI-Biology, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-02-07, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK1, CAMKKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N5S9 (2-289)
      • expression tag (1)
    Domains in SCOPe 2.07: d6ccfa1, d6ccfa2
  • Chain 'B':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK1, CAMKKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N5S9 (2-289)
      • expression tag (1)
    Domains in SCOPe 2.07: d6ccfb1, d6ccfb2
  • Heterogens: H1N, SCN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ccfA (A:)
    smqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqygfprrppprgsqa
    aqggpakqllplervyqeiailkkldhvnvvklievlddpaednlylvfdllrkgpvmev
    pcdkpfseeqarlylrdvilgleylhcqkivhrdikpsnlllgddghvkiadfgvsnqfe
    gndaqlsstagtpafmapeaisdsgqsfsgkaldvwatgvtlycfvygkcpfiddfilal
    hrkiknepvvfpeepeiseelkdlilkmldknpetrigvpdiklhpwvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ccfA (A:)
    mqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkklervyqeiailkkldhvnv
    vklievlddpaednlylvfdllrkgpvmevpcdkpfseeqarlylrdvilgleylhcqki
    vhrdikpsnlllgddghvkiadfgvsnqfegndaqlsstagtpafmapeaisdsgqsfsg
    kaldvwatgvtlycfvygkcpfiddfilalhrkiknepvvfpeepeiseelkdlilkmld
    knpetrigvpdiklhpwvtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ccfB (B:)
    smqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkqygfprrppprgsqa
    aqggpakqllplervyqeiailkkldhvnvvklievlddpaednlylvfdllrkgpvmev
    pcdkpfseeqarlylrdvilgleylhcqkivhrdikpsnlllgddghvkiadfgvsnqfe
    gndaqlsstagtpafmapeaisdsgqsfsgkaldvwatgvtlycfvygkcpfiddfilal
    hrkiknepvvfpeepeiseelkdlilkmldknpetrigvpdiklhpwvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ccfB (B:)
    mqlnqyklqseigkgaygvvrlaynesedrhyamkvlskkkllkervyqeiailkkldhv
    nvvklievlddpaednlylvfdllrkgpvmevpcdkpfseeqarlylrdvilgleylhcq
    kivhrdikpsnlllgddghvkiadfgvsnqfegndaqlsstagtpafmapeaisdsgqsf
    sgkaldvwatgvtlycfvygkcpfiddfilalhrkiknepvvfpeepeiseelkdlilkm
    ldknpetrigvpdiklhpwvtk