PDB entry 6cbv

View 6cbv on RCSB PDB site
Description: Crystal strutcure of BRIL bound to an affinity matured synthetic antibody.
Class: structural protein
Keywords: 4-helix bundle, fusion protein, synthetic antibody, Fab fragment, STRUCTURAL PROTEIN
Deposited on 2018-02-05, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: bril
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-End)
      • engineered mutation (6)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d6cbvb_
  • Chain 'H':
    Compound: Heavy chain, Fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CBV (Start-228)
  • Chain 'L':
    Compound: Light Chain, Fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CBV (Start-213)
    Domains in SCOPe 2.07: d6cbvl1, d6cbvl2
  • Heterogens: GOL, FMT, NA, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cbvB (B:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cbvB (B:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiq
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6cbvL (L:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqylyyslvtfgqgtkveikrtvaapsvfif
    ppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cbvL (L:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqylyyslvtfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg