PDB entry 6cbs

View 6cbs on RCSB PDB site
Description: DnaG Primase C-terminal domain complex with SSB C-terminal peptide
Class: replication
Keywords: Primase, DnaG, Single-strand DNA-Binding Protein, SSB, Complex, REPLICATION
Deposited on 2018-02-05, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase, single-stranded DNA-binding protein chimera
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ssb_1, BUE81_14300, ERS085374_00666
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cbsa1
  • Chain 'B':
    Compound: DNA primase, single-stranded DNA-binding protein chimera
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ssb_1, BUE81_14300, ERS085374_00666
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cbsb1
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cbsA (A:)
    aaesgvsrpvpqlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntcl
    sqpglttgqllehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqee
    liarerthglsneerlelwtlnqelakktresgsigsmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cbsA (A:)
    qlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqll
    ehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthgls
    neerlelwtlnqelakddipf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cbsB (B:)
    aaesgvsrpvpqlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntcl
    sqpglttgqllehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqee
    liarerthglsneerlelwtlnqelakktresgsigsmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cbsB (B:)
    qlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqll
    ehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthgls
    neerlelwtlnqelakddipf