PDB entry 6cbr

View 6cbr on RCSB PDB site
Description: DnaG Primase C-terminal domain complex with SSB C-terminal peptide
Class: replication
Keywords: Primase, DnaG, Single-strand DNA-Binding Protein, SSB, Complex, REPLICATION
Deposited on 2018-02-05, released 2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase,single-stranded DNA-binding protein chimera
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ssb_1, BUE81_14300, ERS085374_00666
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cbra1
  • Chain 'B':
    Compound: DNA primase,single-stranded DNA-binding protein chimera
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ssb_1, BUE81_14300, ERS085374_00666
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cbrb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cbrA (A:)
    aaesgvsrpvpqlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntcl
    sqpglttgqllehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqee
    liarerthglsneerlelwtlnqelakktresgsigsmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cbrA (A:)
    vpqlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgq
    llehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthg
    lsneerlelwtlnqelakkddipf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cbrB (B:)
    aaesgvsrpvpqlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntcl
    sqpglttgqllehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqee
    liarerthglsneerlelwtlnqelakktresgsigsmdfdddipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cbrB (B:)
    qlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqll
    ehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthgls
    neerlelwtlnqeladdipf