PDB entry 6cb4

View 6cb4 on RCSB PDB site
Description: High resolution structure of the hexagonal crystal form of the vicilin protein Canavalin in complex with endogenous benzoic acid
Class: plant protein
Keywords: Jack Bean, storage protein, proteolysis, vicilin, PLANT PROTEIN
Deposited on 2018-02-01, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: canavalin
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50477
      • conflict (245)
    Domains in SCOPe 2.07: d6cb4a1, d6cb4a2
  • Heterogens: BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cb4A (A:)
    mafsarfplwlllgvvllasvsasfahsghsggeaedeseesraqnnpylfrsnkfltlf
    knqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsdsdllvlvlegqailv
    lvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfaitfrrpgtvedfflsst
    krlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkdqiqeiskhaqsssrk
    tlssqnkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
    ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
    dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
    gqprhidaggkarrahlpnlfrtfy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cb4A (A:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkd
    sqnkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsrat
    vilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaasdln
    mvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqp
    r