PDB entry 6cau

View 6cau on RCSB PDB site
Description: UDP-N-acetylmuramate--alanine ligase from Acinetobacter baumannii AB5075-UW with AMPPNP
Class: ligase
Keywords: MurC, SSGCID, AMPPNP, Acinetobacter baumannii AB5075-UW, LIGASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2018-01-31, released 2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylmuramate--L-alanine ligase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: murC, ABBFA_000146
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7GV74 (8-End)
      • expression tag (5-7)
    Domains in SCOPe 2.08: d6caua1, d6caua2, d6caua3
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cauA (A:)
    mahhhhhhmrrikhihfvgiggagmcgiaevlanqgykisgsdikaskttqqleengikv
    yigheaeniknanvlvvstaidpenpevkaaieqripivrraemlgelmryrhgiavagt
    hgkttttsllttmlaeenldptyviggllnstgvnaalgesrfivaeadesdasflylqp
    maaivtnidadhmdtyegsfdklkdtfvqflhnlpfyglavvcgddanireilprvgrpv
    itygfnedndiraidveqdgmrshftvlrkgreplrltinqpglhnvlnalaaigvatde
    gvsdeaisralkgfsgvgrrfqvqgefelgegnvklvddyghhpkeveatikaarqshpd
    rrlvmlfqphrysrtrdcfddfievlsqvdqllllevypagekpivgadsrtlarsirlr
    gqvepilidpvegnlqnimqnvlqpndllltqgagnvgaisvelaqhhlyvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cauA (A:)
    hhhmrrikhihfvgiggagmcgiaevlanqgykisgsdikaskttqqleengikvyighe
    aeniknanvlvvstaidpenpevkaaieqripivrraemlgelmryrhgiavagthgktt
    ttsllttmlaeenldptyviggllnstgvnaalgesrfivaeadesdasflylqpmaaiv
    tnidadgsfdklkdtfvqflhnlpfyglavvcgddanireilprvgrpvitygfnedndi
    raidveqdgmrshftvlrkgreplrltinqpglhnvlnalaaigvatdegvsdeaisral
    kgfsgvg