PDB entry 6caf

View 6caf on RCSB PDB site
Description: High Resolution Structure of Concanavalin B from Jack Bean (Canavalia ensiformis), A Chitinase-like Protein
Class: plant protein
Keywords: SEED PROTEIN, chitinase-like protein, MES, Jack Bean, PLANT PROTEIN
Deposited on 2018-01-30, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin b
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cafa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cafA (A:)
    mgcerkalilmvviwimsfwtlsladissteiavywgqredgllrdtcktnnykivfisf
    ldkfgceirkpelelegvcgpsvgnpcsflesqikecqrmgvkvflalggpkgtysacsa
    dyakdlaeylhtyflserregplgkvaldgihfdiqkpvdelnwdnlleelyqikdvyqs
    tfllsaapgclspdeyldnaiqtrhfdyifvrfyndrscqystgniqrirnawlswtksv
    yprdknlflelpasqatapgggyippsaligqvlpylpdlqtryagialwnrqadketgy
    stniirylnatampftsnllkyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cafA (A:)
    dissteiavywgqredgllrdtcktnnykivfisfldkfgceirkpelelegvcgpsvgn
    pcsflesqikecqrmgvkvflalggpkgtysacsadyakdlaeylhtyflserregplgk
    valdgihfdiqkpvdelnwdnlleelyqikdvyqstfllsaapgclspdeyldnaiqtrh
    fdyifvrfyndrscqystgniqrirnawlswtksvyprdknlflelpasqatapgggyip
    psaligqvlpylpdlqtryagialwnrqadketgystniirylnatam