PDB entry 6cac

View 6cac on RCSB PDB site
Description: Crystal structure of NDM-1 metallo-beta-lactamase harboring an insertion of a Pro residue in L3 loop
Class: hydrolase
Keywords: NDM-1, Zn-containing protein, HYDROLASE
Deposited on 2018-01-30, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (2-End)
      • expression tag (0-1)
      • insertion (38)
    Domains in SCOPe 2.07: d6caca1, d6caca2
  • Chain 'B':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422
      • insertion (38)
    Domains in SCOPe 2.07: d6cacb_
  • Chain 'C':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (2-End)
      • expression tag (0-1)
      • insertion (38)
    Domains in SCOPe 2.07: d6cacc1, d6cacc2
  • Chain 'D':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (2-End)
      • expression tag (0-1)
      • insertion (38)
    Domains in SCOPe 2.07: d6cacd1, d6cacd2
  • Heterogens: ZN, CD, NI, CO, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cacA (A:)
    ghmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtd
    dqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmv
    aaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdska
    kslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cacA (A:)
    ghmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtd
    dqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmv
    aaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdska
    kslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cacB (B:)
    ghmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtd
    dqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmv
    aaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdska
    kslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cacB (B:)
    gdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtddqtaq
    ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
    ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
    lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cacC (C:)
    ghmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtd
    dqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmv
    aaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdska
    kslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cacC (C:)
    ghmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtd
    dqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmv
    aaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdska
    kslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cacD (D:)
    ghmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtd
    dqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmv
    aaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdska
    kslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cacD (D:)
    ghmetgdqrfgdlvfrqlapnvwqhtsyldfgavapsnglivrdggrvlvvdtawtddqt
    aqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaq
    hsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskaksl
    gnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl