PDB entry 6ca9

View 6ca9 on RCSB PDB site
Description: Crystal structure of Fab PCT64_LMCA (SAR), the least mutated common ancestor of the HIV-1 broadly neutralizing antibody lineage PCT64
Class: immune system
Keywords: IgG1, Antibody, HIV-1, bNAb, IMMUNE SYSTEM
Deposited on 2018-01-29, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PCT64_LMCA Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA9 (0-End)
    Domains in SCOPe 2.07: d6ca9a1, d6ca9a2
  • Chain 'B':
    Compound: PCT64_LMCA Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA9 (0-End)
  • Chain 'C':
    Compound: PCT64_LMCA Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA9 (0-End)
    Domains in SCOPe 2.07: d6ca9c1, d6ca9c2
  • Chain 'D':
    Compound: PCT64_LMCA Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA9 (0-End)
  • Heterogens: GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ca9A (A:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsarsftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ca9A (A:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsarsftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ca9C (C:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsarsftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ca9C (C:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsarsftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'D':
    No sequence available.