PDB entry 6ca8

View 6ca8 on RCSB PDB site
Description: Crystal structure of Plasmodium falciparum topoisomerase II DNA-binding, cleavage and re-ligation domain
Class: isomerase
Keywords: Topoisomerase, DNA-binding domain, ISOMERASE
Deposited on 2018-01-29, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase 2
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: TopoII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ca8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ca8A (A:)
    mareriigipkledandagskysqectliltegdsaktsclaglsivgrdkygvfplkgk
    llnvrdasfkqlmdnkeiqnifrimglditdknkddikglrygslmimtdqdydgshikg
    llinmihkfwpsllkhkgflsefvtpivkvqkgsqeysfftiaeyeqwkentnllgwkik
    yykglgtstdrefkqyfsdiknhkimflwtgdrdgdsidmafskkriedrklwlqnfilg
    syvdhkekdlsyydfvnkeliyysrydtersipnimdgwkpgqrkvlygcfkrnlrneck
    vaqlvgyiaehsayhhgesslqqtiinmaqtfvgsnninflepcgqfgsrkeggkdasaa
    ryiftklasstrsifneyddpilkylneegqkiepqyyipviptilvngcegigtgyssf
    ipnynykdiidnikryinkeplipmvpwykdfkgriesngktgyetigiinkidndtlei
    telpikkwtqdykefleelltdekhqlildyidnsshedicftikmdpaklqkaeeegle
    kvfklkstltttnmtlfdpnlklqrysteldilkefcyqrlkayenrksylisklekekr
    iisnktkfilaivnnelivnkkkkkvlveelyrkgydpykdinkikkeeifeqelldaad
    npedneeiiagitvkdydyllsmpifsltlekvedlltqlkekereleilrnitvetmwl
    kdiekveeaiefqrnvelsnreesnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ca8A (A:)
    reriigipkledandagskysqectliltegdsaktsclaglsivgrdkygvfplkgkll
    nvrdasfkqlmdnkeiqnifrimglditdknkddikglrygslmimtdqdydgshikgll
    inmihkfwpsllkhkgflsefvtpivkvqkgsqeysfftiaeyeqwkentnllgwkikyy
    kglgtstdrefkqyfsdiknhkimflwtgdrdgdsidmafskkriedrklwlqnfilgsy
    vdhkekdlsyydfvnkeliyysrydtersipnimdgwkpgqrkvlygcfkrnlrneckva
    qlvgyiaehsayhhgesslqqtiinmaqtfvgsnninflepcgqfgsrkeggkdasaary
    iftklasstrsifneyddpilkylneegqkiepqyyipviptilvngcegigtgyssfip
    nynykdiidnikryinkeplipmvpwykdfkgriesngktgyetigiinkidndtleite
    lpikkwtqdykefleelltdekhqlildyidnsshedicftikmdpaklqkaeeeglekv
    fklkstltttnmtlfdpnlklqrysteldilkefcyqrlkayenrksylisklekekrii
    snktkfilaivnnelivnkkkkkvlveelyrkgydpykdinkeeifeqeledneeiiagi
    tvkdydyllsmpifsltlekvedlltqlkekereleilrnitvetmwlkdiekveeaief
    qrnvelsnree