PDB entry 6ca6

View 6ca6 on RCSB PDB site
Description: Crystal structure of PCT64_35S, a broadly neutralizing anti-HIV antibody.
Class: immune system
Keywords: Antibody, neutralizing, IMMUNE SYSTEM
Deposited on 2018-01-29, released 2018-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.4299999999999997 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PCT64_35S light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA6
    Domains in SCOPe 2.08: d6ca6a1, d6ca6a2
  • Chain 'B':
    Compound: PCT64_35S heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA6 (0-End)
    Domains in SCOPe 2.08: d6ca6b_
  • Chain 'H':
    Compound: PCT64_35S heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA6 (0-End)
    Domains in SCOPe 2.08: d6ca6h_
  • Chain 'L':
    Compound: PCT64_35S light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CA6 (0-End)
    Domains in SCOPe 2.08: d6ca6l1, d6ca6l2
  • Heterogens: PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ca6A (A:)
    eivltqspgtlslspgdratlscratqsvggdyfawyqqrpgqsprlliygtsrraagip
    drfsgsgsgtdftltidrlepedfavyycrqyetsftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ca6A (A:)
    ivltqspgtlslspgdratlscratqsvggdyfawyqqrpgqsprlliygtsrraagipd
    rfsgsgsgtdftltidrlepedfavyycrqyetsftfgpgtkvdikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ca6B (B:)
    evqlvesggglvkpggslrlacvgseftfseawmtwvrqapgkglewvghmrptteggak
    dyaaavrgrftiarddskstlylqmnslkiedtgvyycmtgvergdfwsddysqhyntyl
    idvwgkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgal
    tsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ca6B (B:)
    evqlvesggglvkpggslrlacvgseftfseawmtwvrqapgkglewvghmrptteggak
    dyaaavrgrftiarddskstlylqmnslkiedtgvyycmtgvergdfwsddysqhyntyl
    idvwgkgttvtvssastkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ca6H (H:)
    evqlvesggglvkpggslrlacvgseftfseawmtwvrqapgkglewvghmrptteggak
    dyaaavrgrftiarddskstlylqmnslkiedtgvyycmtgvergdfwsddysqhyntyl
    idvwgkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgal
    tsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ca6H (H:)
    evqlvesggglvkpggslrlacvgseftfseawmtwvrqapgkglewvghmrptteggak
    dyaaavrgrftiarddskstlylqmnslkiedtgvyycmtgvergdfwsddysqhyntyl
    idvwgkgttvtvssastkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ca6L (L:)
    eivltqspgtlslspgdratlscratqsvggdyfawyqqrpgqsprlliygtsrraagip
    drfsgsgsgtdftltidrlepedfavyycrqyetsftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ca6L (L:)
    eivltqspgtlslspgdratlscratqsvggdyfawyqqrpgqsprlliygtsrraagip
    drfsgsgsgtdftltidrlepedfavyycrqyetsftfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge