PDB entry 6c9w

View 6c9w on RCSB PDB site
Description: Crystal Structure of a ligand bound LacY/Nanobody Complex
Class: membrane protein
Keywords: Membrane Protein
Deposited on 2018-01-29, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose permease
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: lacY, b0343, JW0334
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02920
      • engineered mutation (45)
      • engineered mutation (261)
    Domains in SCOPe 2.07: d6c9wa_
  • Chain 'B':
    Compound: Nanobody9047
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C9W (0-124)
    Domains in SCOPe 2.07: d6c9wb_
  • Heterogens: 9PG, BNG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c9wA (A:)
    myylkntnfwmfglffffyffimgayfpffpiwlhdinhisksdtwiifaaislfsllfq
    plfgllsdklglrkyllwiitgmlvmfapffififgpllqynilvgsivggiylgfcfna
    gapaveafiekvsrrsnfefgrarmfgcvgwalcasivgimftinnqfvfwlgsgcalil
    avllffaktdapssatvanavganhsafslklalelfrqpklwflslyvigvsctydvfd
    qqfanfftsffatgeqgtrvfwyvttmgellnasimffapliinriggknalllagtims
    vriigssfatsalevvilktlhmfevpfllvgcfkyitsqfevrfsatiylvcfcffkql
    amifmsvlagnmyesigfqgaylvlglvalgftlisvftlsgpgplsllrrqvneva
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9wA (A:)
    ylkntnfwmfglffffyffimgayfpffpiwlhdinhisksdtwiifaaislfsllfqpl
    fgllsdklglrkyllwiitgmlvmfapffififgpllqynilvgsivggiylgfcfnaga
    paveafiekvsrrsnfefgrarmfgcvgwalcasivgimftinnqfvfwlgsgcalilav
    llffaktdapsshsafslklalelfrqpklwflslyvigvsctydvfdqqfanfftsffa
    tgeqgtrvfwyvttmgellnasimffapliinriggknalllagtimsvriigssfatsa
    levvilktlhmfevpfllvgcfkyitsqfevrfsatiylvcfcffkqlamifmsvlagnm
    yesigfqgaylvlglvalgftlisvftlsgpgplsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c9wB (B:)
    vqlvesggglvqagdslrlscaasggtfstfnmgwfrqdlgkerefvaairwtggrayyg
    dsvkgrftisrdnakntvylqmnslkpedtavyycarqgtngggyseatsynywgqgtqv
    tvssh