PDB entry 6c9u

View 6c9u on RCSB PDB site
Description: Crystal structure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase in complex with antibody fragment (Fab)
Class: TRANSFERASE/immune system
Keywords: DEBS, PKS, polyketide synthase, 6-deoxyerthronolide B synthase, Fab, antibody, phage display, TRANSFERASE-immune system complex
Deposited on 2018-01-28, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03132 (2-End)
      • initiating methionine (0)
      • expression tag (1)
      • conflict (438)
      • conflict (480)
  • Chain 'H':
    Compound: Heavy chain of Fab 1B2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C9U
  • Chain 'L':
    Compound: Light chain of Fab 1B2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C9U
    Domains in SCOPe 2.08: d6c9ul1, d6c9ul2
  • Heterogens: K, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6c9uL (L:)
    lfaiplvvpfyshsaldvvmtqsplslpvtpgepasiscrssqsllhsngynyldwylqk
    pgqspqlliylgsnrasgvpdrfsgsgsgtdftlkisrveaedvgvyycmqslqtprltf
    gpgtkvdikrtvaapsvfifppsdeqlksgtasvvcllnnfyprgakvqwkvdnalqsgn
    sqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9uL (L:)
    dvvmtqsplslpvtpgepasiscrssqsllhsngynyldwylqkpgqspqlliylgsnra
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqslqtprltfgpgtkvdikrtvaaps
    vfifppsdeqlksgtasvvcllnnfyprgakvqwkvqsgnsqesvteqdskdstyslsst
    ltlskadyekhkacevthqglsspvtksf