PDB entry 6c9r

View 6c9r on RCSB PDB site
Description: Mycobacterium tuberculosis adenosine kinase bound to (2R,3S,4R,5R)-2-(hydroxymethyl)-5-(6-(thiophen-3-yl)-9H-purin-9-yl)tetrahydrofuran-3,4-diol
Class: transferase/transferase inhibitor
Keywords: Nucleoside analog, Complex, Inhibitor, Structural Genomics, PSI-2, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-01-28, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: adoK, cbhK, MRA_2218
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4N0 (13-336)
      • expression tag (0-12)
    Domains in SCOPe 2.07: d6c9ra1, d6c9ra2
  • Chain 'B':
    Compound: adenosine kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: adoK, cbhK, MRA_2218
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4N0 (13-336)
      • expression tag (0-12)
    Domains in SCOPe 2.07: d6c9rb1, d6c9rb2
  • Heterogens: ERJ, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c9rA (A:)
    glqgtenlyfqshmtiavtgsiatdhlmrfpgrfseqllpehlhkvslsflvddlvmhrg
    gvagnmafaigvlggevalvgaagadfadyrdwlkargvncdhvlisetahtarftcttd
    vdmaqiasfypgamsearnikladvvsaigkpelviigandpeamflhteecrklglafa
    adpsqqlarlsgeeirrlvngaaylftndyewdlllsktgwseadvmaqidlrvttlgpk
    gvdlvepdgttihvgvvpetsqtdptgvgdafragfltgrsaglglersaqlgslvavlv
    lestgtqewqwdyeaaasrlagaygehaaaeivavla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c9rB (B:)
    glqgtenlyfqshmtiavtgsiatdhlmrfpgrfseqllpehlhkvslsflvddlvmhrg
    gvagnmafaigvlggevalvgaagadfadyrdwlkargvncdhvlisetahtarftcttd
    vdmaqiasfypgamsearnikladvvsaigkpelviigandpeamflhteecrklglafa
    adpsqqlarlsgeeirrlvngaaylftndyewdlllsktgwseadvmaqidlrvttlgpk
    gvdlvepdgttihvgvvpetsqtdptgvgdafragfltgrsaglglersaqlgslvavlv
    lestgtqewqwdyeaaasrlagaygehaaaeivavla