PDB entry 6c9o

View 6c9o on RCSB PDB site
Description: Selenomethionine mutant (V29Sem) of protein GB1 examined by X-ray diffraction
Class: immune system
Keywords: Immunoglobulin G-binding protein G protein, IMMUNE SYSTEM
Deposited on 2018-01-28, released 2019-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (28)
    Domains in SCOPe 2.08: d6c9oa1, d6c9oa2
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • expression tag (0-1)
      • engineered mutation (28)
    Domains in SCOPe 2.08: d6c9ob1, d6c9ob2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c9oA (A:)
    gqyklilngktlkgettteavdaataekmfkqyandngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c9oB (B:)
    gqyklilngktlkgettteavdaataekmfkqyandngvdgewtyddatktftvte