PDB entry 6c9m

View 6c9m on RCSB PDB site
Description: The Human NatA (Naa10/Naa15) amino-terminal acetyltransferase complex
Class: transferase
Keywords: NatA, N-terminal acetylation, protein complex, TRANSFERASE
Deposited on 2018-01-26, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-alpha-acetyltransferase 15, NatA auxiliary subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA15, GA19, NARG1, NATH, TBDN100
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: N-alpha-acetyltransferase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA10, ARD1, ARD1A, TE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9mb_
  • Chain 'C':
    Compound: N-alpha-acetyltransferase 15, NatA auxiliary subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA15, GA19, NARG1, NATH, TBDN100
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: N-alpha-acetyltransferase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA10, ARD1, ARD1A, TE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9md_
  • Heterogens: IHP, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c9mB (B:)
    mnirnarpedlmnmqhcnllclpenyqmkyyfyhglswpqlsyiaedengkivgyvlakm
    eedpddvphghitslavkrshrrlglaqklmdqasramienfnakyvslhvrksnraalh
    lysntlnfqisevepkyyadgedayamkrdltqmadelrrhlelkekgrhvvlgaienkv
    eskgnsppssgeacreekglaaedsggdskdlsevsettestdvkdsseasdsas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9mB (B:)
    mnirnarpedlmnmqhcnllclpenyqmkyyfyhglswpqlsyiaedengkivgyvlakm
    eedpddvphghitslavkrshrrlglaqklmdqasramienfnakyvslhvrksnraalh
    lysntlnfqisevepkyyadgedayamkrdltqmadelrr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c9mD (D:)
    mnirnarpedlmnmqhcnllclpenyqmkyyfyhglswpqlsyiaedengkivgyvlakm
    eedpddvphghitslavkrshrrlglaqklmdqasramienfnakyvslhvrksnraalh
    lysntlnfqisevepkyyadgedayamkrdltqmadelrrhlelkekgrhvvlgaienkv
    eskgnsppssgeacreekglaaedsggdskdlsevsettestdvkdsseasdsas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9mD (D:)
    mnirnarpedlmnmqhcnllclpenyqmkyyfyhglswpqlsyiaedengkivgyvlakm
    eedpddvphghitslavkrshrrlglaqklmdqasramienfnakyvslhvrksnraalh
    lysntlnfqisevepkyyadgedayamkrdltqmadelrr