PDB entry 6c9l

View 6c9l on RCSB PDB site
Description: MEF2B Apo Protein Structure
Class: transcription
Keywords: MEF2, MEF2B, MEF2B Apo Structure, Self-regulatory protein, TRANSCRIPTION
Deposited on 2018-01-26, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2B, XMEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9la_
  • Chain 'B':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2B, XMEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9lb_
  • Chain 'C':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2B, XMEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9lc_
  • Chain 'D':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2B, XMEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9ld_
  • Chain 'E':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2B, XMEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9le_
  • Chain 'F':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: MEF2B, XMEF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9lf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c9lA (A:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9lA (A:)
    qisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastdmdrvl
    lkyteysephesrtntdiletlkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c9lB (B:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9lB (B:)
    iqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastdmdrv
    llkyteysephesrtntdiletlkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c9lC (C:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9lC (C:)
    kiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastdmdr
    vllkyteysephesrtntdiletlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c9lD (D:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9lD (D:)
    qisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastdmdrvl
    lkyteysephesrtntdiletlkr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6c9lE (E:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9lE (E:)
    srildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastdmdrvllk
    ytey
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6c9lF (F:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9lF (F:)
    isrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastdmdrvll
    kyteysetntdiletlk