PDB entry 6c9e

View 6c9e on RCSB PDB site
Description: Crystal structure of Cysteine desulfurase from Legionella pneumophila Philadelphia 1
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2018-01-26, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: lpg0604
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9ea_
  • Chain 'B':
    Compound: Cysteine desulfurase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: lpg0604
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c9eb_
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c9eA (A:)
    mahhhhhhmstnpslmtsfdvnkirkdfpvlhqkineydlvyfdnaattqkpkavidaia
    qfyekdnsnvhrgvhalsvratemyeaarakvkrfinarsprecifvrgtteainlvaqs
    lvaprilpdeeilithmehhsnivpwqmvckkmgcklqvapislngevileeferklnen
    tkmvainyasnslgtinpvktmikmahevgakvlldgaqatahlivdvqdldcdfyafsg
    hkmygptgigvlwgkeellnsmtpyqgggeminsvsfeateyaaiphkfeagtpniagai
    glaaaidyiwsldldaiaeyetqllnyatkaieavkgyniigtaankvpiisfvhgkiha
    hdigtildsegiairsghhctmplmdfydvaatsrismsfyntfkeidycmealqrvkev
    fa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9eA (A:)
    sfdvnkirkdfpvlhqkineydlvyfdnaattqkpkavidaiaqfyekdnsnvhrgvhal
    svratemyeaarakvkrfinarsprecifvrgtteainlvaqslvaprilpdeeilithm
    ehhsnivpwqmvckkmgcklqvapislngevileeferklnentkmvainyasnslgtin
    pvktmikmahevgakvlldgaqatahlivdvqdldcdfyafsghkmygptgigvlwgkee
    llnsmtpyqgggeminsvsfeateyaaiphkfeagtpniagaiglaaaidyiwsldldai
    aeyetqllnyatkaieavkgyniigtaankvpiisfvhgkihahdigtildsegiairsg
    hhctmplmdfydvaatsrismsfyntfkeidycmealqrvkevfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c9eB (B:)
    mahhhhhhmstnpslmtsfdvnkirkdfpvlhqkineydlvyfdnaattqkpkavidaia
    qfyekdnsnvhrgvhalsvratemyeaarakvkrfinarsprecifvrgtteainlvaqs
    lvaprilpdeeilithmehhsnivpwqmvckkmgcklqvapislngevileeferklnen
    tkmvainyasnslgtinpvktmikmahevgakvlldgaqatahlivdvqdldcdfyafsg
    hkmygptgigvlwgkeellnsmtpyqgggeminsvsfeateyaaiphkfeagtpniagai
    glaaaidyiwsldldaiaeyetqllnyatkaieavkgyniigtaankvpiisfvhgkiha
    hdigtildsegiairsghhctmplmdfydvaatsrismsfyntfkeidycmealqrvkev
    fa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c9eB (B:)
    tsfdvnkirkdfpvlhqkineydlvyfdnaattqkpkavidaiaqfyekdnsnvhrgvha
    lsvratemyeaarakvkrfinarsprecifvrgtteainlvaqslvaprilpdeeilith
    mehhsnivpwqmvckkmgcklqvapislngevileeferklnentkmvainyasnslgti
    npvktmikmahevgakvlldgaqatahlivdvqdldcdfyafsghkmygptgigvlwgke
    ellnsmtpyqgggeminsvsfeateyaaiphkfeagtpniagaiglaaaidyiwsldlda
    iaeyetqllnyatkaieavkgyniigtaankvpiisfvhgkihahdigtildsegiairs
    ghhctmplmdfydvaatsrismsfyntfkeidycmealqrvkevfa