PDB entry 6c91

View 6c91 on RCSB PDB site
Description: Structure of GRP94 with a resorcinylic inhibitor.
Class: chaperone/inhibitor
Keywords: chaperone, inhibitor, endoplasmin, chaperone-inhibitor complex
Deposited on 2018-01-25, released 2018-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: HSP90B1, GRP94, TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6c91b_
  • Chain 'C':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: HSP90B1, GRP94, TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (Start-221)
      • linker (222-225)
    • Uniprot P41148 (226-235)
    Domains in SCOPe 2.08: d6c91c_
  • Heterogens: SO4, EQD, EDO, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c91B (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c91B (B:)
    reksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagn
    eeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtsedgqstseligqfgvgf
    ysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyl
    eldtiknlvkkysqfinfpiyvwsskttvwdwelmn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c91C (C:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c91C (C:)
    ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
    vkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtsqstseligqfgvgfysaflva
    dkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtikn
    lvkkysqfinfpiyvwssktggggktvwdwelmn