PDB entry 6c80

View 6c80 on RCSB PDB site
Description: Crystal structure of a flax cytokinin oxidase
Class: immune system
Keywords: Plant immunity, Effector, Cytokinin, Cytokinin oxidase, IMMUNE SYSTEM
Deposited on 2018-01-23, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytokinin oxidase LuCKX1.1
    Species: Linum usitatissimum [TaxId:4006]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C80 (0-End)
    Domains in SCOPe 2.08: d6c80a1, d6c80a2
  • Chain 'B':
    Compound: cytokinin oxidase LuCKX1.1
    Species: Linum usitatissimum [TaxId:4006]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C80 (0-488)
    Domains in SCOPe 2.08: d6c80b1, d6c80b2
  • Heterogens: FAD, PEG, GOL, PG6, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c80A (A:)
    sldlqgsidystlaagkdfggvyssnplalirpsgaddvarvlksacrssnltvaargng
    hsingqamadggivldmrstegnhfkilringgdhyadvsggalwedilmrcvseyglap
    rswtdylrltvggtlsnagvsgqafrygpqssnvteldvvtgkgdfltcsptqnsdlffg
    algglgqfgvitrariplepapdmvrwirmvyaefedfsrdaewlvtqpekesfdyvegf
    afvnsdspadgwpsvplnhmmttpihsghqllyclelalhfnhsnssstvdsvvkrligg
    lrymkgfkyevdlsyvefvmrvkrveedarahgmwdaphpwlnlfvskadiaefdrlifk
    gllhdgvggpmlvypllrskwdsrssvvlpegedeifyivallrsnppypkgpsvdklvs
    qndkiiqsciqhglgfklylphyqsqhdwrrhfgdqwskfvqlklafdpmavlapgqkif
    trrtkkdpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c80A (A:)
    sldlqgsidystlaagkdfggvyssnplalirpsgaddvarvlksacrssnltvaargng
    hsingqamadggivldmrstegnhfkilrigdhyadvsggalwedilmrcvseyglaprs
    wtdylrltvggtlsnagvsgqafrygpqssnvteldvvtgkgdfltcsptqnsdlffgal
    gglgqfgvitrariplepapdmvrwirmvyaefedfsrdaewlvtqpekesfdyvegfaf
    vnsdspadgwpsvplnpihsghqllyclelalhfnhsnssstvdsvvkrligglrymkgf
    kyevdlsyvefvmrvkrveedarahgmwdaphpwlnlfvskadiaefdrlifkgllhdgv
    ggpmlvypllrskwdsrssvvlpegedeifyivallrsnppypkgpsvdklvsqndkiiq
    sciqhglgfklylphyqsqhdwrrhfgdqwskfvqlklafdpmavlapgqkiftrrtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c80B (B:)
    sldlqgsidystlaagkdfggvyssnplalirpsgaddvarvlksacrssnltvaargng
    hsingqamadggivldmrstegnhfkilringgdhyadvsggalwedilmrcvseyglap
    rswtdylrltvggtlsnagvsgqafrygpqssnvteldvvtgkgdfltcsptqnsdlffg
    algglgqfgvitrariplepapdmvrwirmvyaefedfsrdaewlvtqpekesfdyvegf
    afvnsdspadgwpsvplnhmmttpihsghqllyclelalhfnhsnssstvdsvvkrligg
    lrymkgfkyevdlsyvefvmrvkrveedarahgmwdaphpwlnlfvskadiaefdrlifk
    gllhdgvggpmlvypllrskwdsrssvvlpegedeifyivallrsnppypkgpsvdklvs
    qndkiiqsciqhglgfklylphyqsqhdwrrhfgdqwskfvqlklafdpmavlapgqkif
    trrtkkdpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c80B (B:)
    sldlqgsidystlaagkdfggvyssnplalirpsgaddvarvlksacrssnltvaargng
    hsingqamadggivldmrstegnhfkilrgdhyadvsggalwedilmrcvseyglaprsw
    tdylrltvggtlsnagvsgqafrygpqssnvteldvvtgkgdfltcsptqnsdlffgalg
    glgqfgvitrariplepapdmvrwirmvyaefedfsrdaewlvtqpekesfdyvegfafv
    nsdspadgwpsvplnhmmttpihsghqllyclelalhfnhsnssstvdsvvkrligglry
    mkgfkyevdlsyvefvmrvkrveedarahgmwdaphpwlnlfvskadiaefdrlifkgll
    hdgvggpmlvypllrskwdsrssvvlpegedeifyivallrsnppypkgpsvdklvsqnd
    kiiqsciqhglgfklylphyqsqhdwrrhfgdqwskfvqlklafdpmavlapgqkiftrr
    tkkdpa