PDB entry 6c7z

View 6c7z on RCSB PDB site
Description: Crystal structure of the Q108K:K40L:T51V:R58F mutant of human Cellular Retinol Binding Protein II in complex with synthetic Ligand Julolidine
Class: transport protein
Keywords: Protein Engineering, Ratiometric pH probe, hCRBPII, TRANSPORT PROTEIN
Deposited on 2018-01-23, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (39)
      • engineered mutation (50)
      • engineered mutation (57)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d6c7za_
  • Chain 'B':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (39)
      • engineered mutation (50)
      • engineered mutation (57)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d6c7zb_
  • Heterogens: ACT, JLO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c7zA (A:)
    trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfkvkttstffny
    dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
    cgdqvcrqvfkkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c7zB (B:)
    trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfkvkttstffny
    dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
    cgdqvcrqvfkkk