PDB entry 6c7y

View 6c7y on RCSB PDB site
Description: Crystal structure of inhibitory protein SOCS1 in complex with JAK1 kinase domain
Class: signaling protein, transferase/inhibitor
Keywords: Kinase, Kinase Inhibitor, SIGNALING PROTEIN, TRANSFERASE-INHIBITOR complex
Deposited on 2018-01-23, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1, JAK1A, JAK1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23458 (1-285)
      • expression tag (0)
    Domains in SCOPe 2.07: d6c7ya1, d6c7ya2
  • Chain 'B':
    Compound: Suppressor of cytokine signaling 1
    Species: Gallus gallus [TaxId:9031]
    Gene: SOCS1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, MG, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c7yA (A:)
    ahfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkpesggnhiadlkkeie
    ilrnlyhenivkykgictedggngiklimeflpsgslkeylpknknkinlkqqlkyavqi
    ckgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspvfw
    yapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlvnt
    lkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeall
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c7yA (A:)
    ahfekrflkrirdlgeghfgkvelcrygdntgeqvavkslkphiadlkkeieilrnlyhe
    nivkykgictegiklimeflpsgslkeylpknknkinlkqqlkyavqickgmdylgsrqy
    vhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspvfwyapeclmqskfy
    iasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlvntlkegkrlpcppn
    cpdevyqlmrkcwefqpsnrtsfqnliegfeall
    

  • Chain 'B':
    No sequence available.