PDB entry 6c7q

View 6c7q on RCSB PDB site
Description: BRD4 BD2 in complex with compound CE277
Class: transcription/transcription inhibitor
Keywords: BROMODOMAIN, TRANSCRIPTION, transcription-transcription inhibitor complex
Deposited on 2018-01-23, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c7qa_
  • Heterogens: EO1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c7qA (A:)
    snakdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhd
    ycdiikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdv
    femrfakmpde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c7qA (A:)
    kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
    areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpde