PDB entry 6c7k

View 6c7k on RCSB PDB site
Description: Crystal structure of an ACO/RPE65 chimera
Class: oxidoreductase
Keywords: non-heme iron, chimera, 7-bladed propeller, OXIDOREDUCTASE
Deposited on 2018-01-22, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74334 (Start-489)
      • engineered mutation (43-44)
      • engineered mutation (430-431)
      • engineered mutation (433-436)
      • engineered mutation (441)
      • engineered mutation (460)
      • engineered mutation (462)
    Domains in SCOPe 2.07: d6c7ka_
  • Chain 'B':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74334 (Start-489)
      • engineered mutation (43-44)
      • engineered mutation (430-431)
      • engineered mutation (433-436)
      • engineered mutation (441)
      • engineered mutation (460)
      • engineered mutation (462)
    Domains in SCOPe 2.07: d6c7kb_
  • Chain 'C':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74334 (Start-489)
      • engineered mutation (43-44)
      • engineered mutation (430-431)
      • engineered mutation (433-436)
      • engineered mutation (441)
      • engineered mutation (460)
      • engineered mutation (462)
    Domains in SCOPe 2.07: d6c7kc_
  • Chain 'D':
    Compound: Apocarotenoid-15,15'-oxygenase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: sll1541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74334 (Start-489)
      • engineered mutation (43-44)
      • engineered mutation (430-431)
      • engineered mutation (433-436)
      • engineered mutation (441)
      • engineered mutation (460)
      • engineered mutation (462)
    Domains in SCOPe 2.07: d6c7kd_
  • Heterogens: FE2, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c7kA (A:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvshpdaleeddgvllcliykadlhrselvilnakditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c7kA (A:)
    qrsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvs
    hpdaleeddgvllcliykadlhrselvilnakditapaiatlklkhhipyplhgswaqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c7kB (B:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvshpdaleeddgvllcliykadlhrselvilnakditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c7kB (B:)
    qrsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvs
    hpdaleeddgvllcliykadlhrselvilnakditapaiatlklkhhipyplhgswaqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c7kC (C:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvshpdaleeddgvllcliykadlhrselvilnakditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c7kC (C:)
    rsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpglleigdrplkhpfdgd
    gmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlkn
    iantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpastf
    dggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflqn
    nvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafeen
    gkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccefp
    vvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvsh
    pdaleeddgvllcliykadlhrselvilnakditapaiatlklkhhipyplhgswaqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c7kD (D:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvshpdaleeddgvllcliykadlhrselvilnakditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c7kD (D:)
    rsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpglleigdrplkhpfdgd
    gmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlkn
    iantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpastf
    dggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflqn
    nvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafeen
    gkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccefp
    vvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvsh
    pdaleeddgvllcliykadlhrselvilnakditapaiatlklkhhipyplhgswaqt