PDB entry 6c7i

View 6c7i on RCSB PDB site
Description: Crystal structure of human phosphodiesterase 2A with 1-(2-chloro-5-methoxy-phenyl)-N-isobutyl-4-methyl-[1,2,4]triazolo[4,3-a]quinoxaline-8-carboxamide
Class: hydrolase
Keywords: phosphodiesterase, HYDROLASE
Deposited on 2018-01-22, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00408 (3-341)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6c7ia1, d6c7ia2
  • Chain 'B':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00408 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d6c7ib1, d6c7ib2
  • Chain 'C':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c7ic_
  • Chain 'D':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c7id_
  • Heterogens: EP7, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c7iA (A:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c7iB (B:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfld
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c7iB (B:)
    amddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidc
    ptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmch
    dldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqr
    mldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgw
    kttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqd
    lfpkaaelyervasnrehwtkvshkftirglpsnnsldfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c7iC (C:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfld
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c7iC (C:)
    eytkllhiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarf
    clmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrg
    tnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmr
    diilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrki
    aeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaa
    elyervasnrehwtkvshkftirglpsnnsldfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c7iD (D:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfld
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c7iD (D:)
    eytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptla
    rfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldh
    rgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldl
    mrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttr
    kiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpk
    aaelyervasnrehwtkvshkftirglpsnnsldfld