PDB entry 6c74

View 6c74 on RCSB PDB site
Description: Crystal Structure of Murine CD300lf in complex with phosphocholine
Class: lipid binding protein
Keywords: CD300lf, IgV-like domain, LIPID BINDING PROTEIN, myeloid receptor, CMRF-35-like molecule-1, CLM-1, CLM1, DIR2, IREM1, LMIR3, PIGR3. IgSF13
Deposited on 2018-01-19, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CMRF35-like molecule-1
    Species: Mus musculus [TaxId:10090]
    Gene: Cd300lf, Clm1, Lmir3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c74a_
  • Heterogens: PC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6c74A (A:)
    edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
    rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvp