PDB entry 6c6o

View 6c6o on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 2-Br-4-OH-phenyldiketoacid
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: Acetyltransferase, Structural Genomics, TB Structural Genomics Consortium, TBSGC, TRANSFERASE, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2018-01-19, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate synthase g
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glcB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c6oa_
  • Heterogens: MG, ENG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c6oA (A:)
    mtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardel
    qaqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvp
    vlnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsv
    plssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhie
    ilidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdla
    aavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfe
    gimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvl
    glpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrk
    gtmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragasta
    wvpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdn
    ncqsilgyvvrwvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvra
    slermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrre
    fkaraaekpapsdragddaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c6oA (A:)
    tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
    aqidkwhrrrdmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvlnarf
    alnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvplssgs
    fgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilidpe
    sqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaarvlnr
    drnytagqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftgliaihglkas
    gplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigimdeerrttvnl
    kacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilayedhnvdagla
    agfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlhalhyhqvdvaa
    vqqglagkrratieqlltiplakwapdeireevdnncqsilgyvvrwvdqgvgaskvpdi
    hdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrqnvayrpmapnfdd
    siaflaaqelilsgaqqpngytepilhrrrrefkaraae