PDB entry 6c6m

View 6c6m on RCSB PDB site
Description: IgCam3 of human MLCK1
Class: cell adhesion
Keywords: IgCAM MLCK1 IBD, CELL ADHESION
Deposited on 2018-01-19, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin light chain kinase, smooth muscle
    Species: Homo sapiens [TaxId:9606]
    Gene: MYLK, MLCK, MLCK1, MYLK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c6ma_
  • Chain 'B':
    Compound: Myosin light chain kinase, smooth muscle
    Species: Homo sapiens [TaxId:9606]
    Gene: MYLK, MLCK, MLCK1, MYLK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c6mb_
  • Chain 'C':
    Compound: Myosin light chain kinase, smooth muscle
    Species: Homo sapiens [TaxId:9606]
    Gene: MYLK, MLCK, MLCK1, MYLK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c6mc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c6mA (A:)
    megqrdsafpkfeskpqsqevkenqtvkfrcevsgipkpevawflegtpvrrqegsievy
    edagshylcllkartrdsgtysctasnaqgqlscswtlqverl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c6mA (A:)
    fpkfeskpqsqevkenqtvkfrcevsgipkpevawflegtpvrrqegsievyedagshyl
    cllkartrdsgtysctasnaqgqlscswtlqverl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c6mB (B:)
    megqrdsafpkfeskpqsqevkenqtvkfrcevsgipkpevawflegtpvrrqegsievy
    edagshylcllkartrdsgtysctasnaqgqlscswtlqverl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c6mB (B:)
    fpkfeskpqsqevkenqtvkfrcevsgipkpevawflegtpvrrqegsievyedagshyl
    cllkartrdsgtysctasnaqgqlscswtlqver
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c6mC (C:)
    megqrdsafpkfeskpqsqevkenqtvkfrcevsgipkpevawflegtpvrrqegsievy
    edagshylcllkartrdsgtysctasnaqgqlscswtlqverl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c6mC (C:)
    fpkfeskpqsqevkenqtvkfrcevsgipkpevawflegtpvrrqegsievyedagshyl
    cllkartrdsgtysctasnaqgqlscswtlqverl