PDB entry 6c68

View 6c68 on RCSB PDB site
Description: MHC-independent t cell receptor A11
Class: immune system
Keywords: MHC-independent t cell receptor, IMMUNE SYSTEM
Deposited on 2018-01-18, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C68 (Start-205)
    Domains in SCOPe 2.07: d6c68a1, d6c68a2
  • Chain 'B':
    Compound: T-cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C68
    Domains in SCOPe 2.07: d6c68b1, d6c68b2
  • Chain 'C':
    Compound: T-cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C68 (Start-205)
    Domains in SCOPe 2.07: d6c68c1, d6c68c2
  • Chain 'D':
    Compound: T-cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C68
    Domains in SCOPe 2.07: d6c68d1, d6c68d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c68A (A:)
    mdsvtqteglvtvteglpvmlnctyqtaysdvaffwyvqylneapklllrsstdnkrteh
    qgfhatlhkssssfhlqkssvqlsdsalyycalsphntgnykyvfgagtrlkviahiqnp
    dpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    snksdfacanafnnsiipedtffpsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c68A (A:)
    dsvtqteglvtvteglpvmlnctyqtaysdvaffwyvqylneapklllrsstdnkrtehq
    gfhatlhkssssfhlqkssvqlsdsalyycalsphntgnykyvfgagtrlkviahiqnpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c68B (B:)
    mavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdip
    dgykasrpsqenfslilelaslsqtavyfcassqtnsdytfgsgtrllviedlrnvfppe
    vavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c68B (B:)
    avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
    gykasrpsqenfslilelaslsqtavyfcassqtnsdytfgsgtrllviedlrnvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6c68C (C:)
    mdsvtqteglvtvteglpvmlnctyqtaysdvaffwyvqylneapklllrsstdnkrteh
    qgfhatlhkssssfhlqkssvqlsdsalyycalsphntgnykyvfgagtrlkviahiqnp
    dpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    snksdfacanafnnsiipedtffpsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c68C (C:)
    dsvtqteglvtvteglpvmlnctyqtaysdvaffwyvqylneapklllrsstdnkrtehq
    gfhatlhkssssfhlqkssvqlsdsalyycalsphntgnykyvfgagtrlkviahiqnpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipedtffpsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6c68D (D:)
    mavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdip
    dgykasrpsqenfslilelaslsqtavyfcassqtnsdytfgsgtrllviedlrnvfppe
    vavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c68D (D:)
    avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
    gykasrpsqenfslilelaslsqtavyfcassqtnsdytfgsgtrllviedlrnvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra