PDB entry 6c67

View 6c67 on RCSB PDB site
Description: Mycobacterium tuberculosis adenosine kinase bound to iodotubercidin
Class: transferase/transferase inhibitor
Keywords: Nucleoside analog, Complex, Inhibitor, Structural Genomics, PSI-2, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-01-17, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: adoK, cbhK, Rv2202c, MTCY190.13c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c67a_
  • Chain 'B':
    Compound: adenosine kinase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: adoK, cbhK, Rv2202c, MTCY190.13c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6c67b_
  • Heterogens: 5ID, NA, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c67A (A:)
    mtiavtgsiatdhlmrfpgrfseqllpehlhkvslsflvddlvmhrggvagnmafaigvl
    ggevalvgaagadfadyrdwlkargvncdhvlisetahtarftcttdvdmaqiasfypga
    msearnikladvvsaigkpelviigandpeamflhteecrklglafaadpsqqlarlsge
    eirrlvngaaylftndyewdlllsktgwseadvmaqidlrvttlgpkgvdlvepdgttih
    vgvvpetsqtdptgvgdafragfltgrsaglglersaqlgslvavlvlestgtqewqwdy
    eaaasrlagaygehaaaeivavla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c67A (A:)
    tiavtgsiatdhlmrfpgrfseqvslsflvddlvmhrggvagnmafaigvlggevalvga
    agadfadyrdwlkargvncdhvlisetahtarftcttdvdmaqiasfypgamsearnikl
    advvsaigkpelviigandpeamflhteecrklglafaadpsqqlarlsgeeirrlvnga
    aylftndyewdlllsktgwseadvmaqidlrvttlgpkgvdlvepdgttihvgvvpetsq
    tdptgvgdafragfltgrsaglglersaqlgslvavlvlestgtqewqwdyeaaasrlag
    aygehaaaeivav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c67B (B:)
    mtiavtgsiatdhlmrfpgrfseqllpehlhkvslsflvddlvmhrggvagnmafaigvl
    ggevalvgaagadfadyrdwlkargvncdhvlisetahtarftcttdvdmaqiasfypga
    msearnikladvvsaigkpelviigandpeamflhteecrklglafaadpsqqlarlsge
    eirrlvngaaylftndyewdlllsktgwseadvmaqidlrvttlgpkgvdlvepdgttih
    vgvvpetsqtdptgvgdafragfltgrsaglglersaqlgslvavlvlestgtqewqwdy
    eaaasrlagaygehaaaeivavla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c67B (B:)
    tiavtgsiatdhlmrfpgrfseqlvslsflvddlvmhrggvagnmafaigvlggevalvg
    aagadfadyrdwlkargvncdhvlisetahtarftcttdvdmaqiasfypgamsearnik
    ladvvsaigkpelviigandpeamflhteecrklglafaadpsqqlarlsgeeirrlvng
    aaylftndyewdlllsktgwseadvmaqidlrvttlgpkgvdlvepdgttihvgvvpets
    qtdptgvgdafragfltgrsaglglersaqlgslvavlvlestgtqewqwdyeaaasrla
    gaygehaaaeivav