PDB entry 6c61

View 6c61 on RCSB PDB site
Description: MHC-independent T-cell receptor B12A
Class: immune system
Keywords: MHC-independent t cell receptor, IMMUNE SYSTEM
Deposited on 2018-01-17, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C61 (Start-206)
    Domains in SCOPe 2.07: d6c61a1, d6c61a2
  • Chain 'B':
    Compound: T-cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6C61
    Domains in SCOPe 2.07: d6c61b1, d6c61b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6c61A (A:)
    mdsvtqtegpvtvsesdsliinctysatsiaypnffwyvrypgeglqlllkvitagqkgs
    srgfeatynkettsfhlqkasvqesdsavyycalgiitgntgklifglgttlqvqpdiqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c61A (A:)
    dsvtqtegpvtvsesdsliinctysatsiaypnffwyvrypgeglqlllkvitagqkgss
    rgfeatynkettsfhlqkasvqesdsavyycalgiitgntgklifglgttlqvqpdiqnp
    dpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    snksdfacanafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6c61B (B:)
    mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
    ekrfsaecpsnspcsleiqsseagdsalylcasspgqgaatgqlyfgegskltvledlrn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6c61B (B:)
    kviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmte
    krfsaecpsnspcsleiqsseagdsalylcasspgqgaatgqlyfgegskltvledlrnv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    gra